PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g063100.3
Common NameMTR_4g063100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 225aa    MW: 26100.9 Da    PI: 5.5848
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g063100.3genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.2e-173378148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T++E+ l  +++ ++G++ W++Iar+++ gRt++++k++w++++
  Medtr4g063100.3 33 RGKMTPQEERLVMELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 78
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-91339IPR009057Homeodomain-like
PROSITE profilePS500904.2521327IPR017877Myb-like domain
SuperFamilySSF466892.38E-211384IPR009057Homeodomain-like
PROSITE profilePS5129427.3422882IPR017930Myb domain
SMARTSM007176.6E-163280IPR001005SANT/Myb domain
PfamPF002491.5E-153377IPR001005SANT/Myb domain
CDDcd001671.57E-113578No hitNo description
Gene3DG3DSA:1.10.10.609.2E-214079IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MFFCFSHFVV GLSRSGKSCR LRWVNYLHPD LKRGKMTPQE ERLVMELHSK WGNRWSRIAR  60
KLPGRTDNEI KNYWRTHMRK KRAQEKKHAT PSISSSPDQS SSCQSSHFSN SNHGVDSHAS  120
NKESEEENYQ VQEIEQGYSM DDIWKDIAMS EDDINVLQPD FDGTSEENSN NLSCPIMPST  180
SSWDYSYLDP LWVMDEEESK MLFPPIGDQY FSFYDQQGNT FLTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-19138136104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.111830.0leaf| root| stem
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1392880.0BT139288.1 Medicago truncatula clone JCVI-FLMt-11A19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003606615.21e-170myb transcription factor
SwissprotQ4JL843e-58MYB59_ARATH; Transcription factor MYB59
TrEMBLG7JTP41e-170G7JTP4_MEDTR; Myb transcription factor
STRINGGLYMA15G04620.11e-76(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.21e-57myb domain protein 59
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]